Sentencedict.com
 Directly to word page Vague search(google)
Home > Herpes simplex in a sentence

Herpes simplex in a sentence

  up(0)  down(0)
Sentence count:57Posted:2017-07-19Updated:2020-07-24
Similar words: simplesimpletonpessimistpessimismpessimisticpure and simplesimple machinesimple interestMeaning: n. 1. an infection caused by the herpes simples virus; affects the skin and nervous system; produces small temporary (but sometimes painful) blisters on the skin and mucous membranes 2. a herpes virus that affects the skin and nervous system. 
Random good picture Not show
31. These include giant cells associated with variola, herpes simplex and parainfluenza.
32. An Indian scientist claims to have identified two plants in the Nilgiri hills that may contain a cure for life-threatening diseases caused by Herpes Simplex Virus (HSV).
33. At present, the mainly applied virus vectors are retroviral vector, adenovirus vector adenovirus-associated virus slow virus vector, herpes simplex virus vector and so on.
34. Objective : To investigate therapeutic effect of cornea toxicide for treating herpes simplex viral keratitis.
35. Herpes simplex keratitis ( HSK ) is one of the most important causes of blindness.
36. Methods:Cytotoxity of acyclovir(ACV)on Vero cell and antiviral activity of ACV on herpes simplex virus type 1(HSV-1)in vitro were detected using two methods.
37. Herpes simplex virus ( HSV ) gains entry through abraded skin or mucosal tissue.
38. A viral infection caused by the herpes simplex virus type 2[sentencedict.com], occasionally type 1.
39. This is typical for Herpes simplex virus ( HSV ) infection.
40. Objective To investigate the combined clinical effect of trace corticosteroid and antiviral agent against herpes simplex keratitis (HSK).
41. Among STDs, herpes simplex virus type 2 (HSV-2) infects one in six in the nation.
42. Assuming these findings extend to neurons, they provide a plausible mechanism for herpes simplex encephalitis.
43. Conclusion The data indicate that neurotropic herpes simplex virus type i amplicon vector bearing CGRP gene has protective effect on CVS, which has relation with inhibiting apoptosis.
44. Research is underway concerning the use of BHT in the treatment of herpes simplex and AIDS.
45. Objective To evaluate the effects of early versus delayed glucocorticoid administration in combination with antivirus drug in a model of herpes simplex encephalitis.
45. Sentencedict.com is a sentence dictionary, on which you can find good sentences for a large number of words.
46. Objective To evaluate the efficacy of acyclovir used to treat herpes simplex encephalitis.
47. Objective : To study the clinical characteristic of herpes simplex virus encephalitis ( HSE ) and the EEG.
48. Participants were also tested for herpes simplex virus 1 (HSV-1), which causes most cold sores.
49. An Indian scientist claims to have identified two plants in the Nilgiri hills that may contain a cure for life-threatening diseases caused by Herpes Simplex Virus.
50. The esophageal squamous epithelium here is from a sharply demarcated "punched out" ulcer from Herpes simplex virus infection. Note the mauve to pink intranuclear inclusions.
51. MRI of herpes simplex encephalitis in them had its characteristic manifestation.
52. Objective To construct the DNA vaccine against type 2 herpes simplex virus(HSV-2) modified by ubiquitinated infectious cell protein 27(ICP27).
53. The survival strategy of herpes simplex virus centers on developing latent infection and periodic reactivation.
54. Viral encephalitis is a common cause of symptomatic epilepsy. The most frequent and serious epilepsy is generated by herpes simplex encephalitis.
55. Objective To explore the value of CT and MRI in the early diagnosis of acute type I Herpes simplex encephalitis (HSE).
56. Herpes simplex virus 1 ( HSV - 1 ) multiplies and spreads in mammalian nervous system to cause lethal encephalitis.
57. In fact, those who have HIV oftentimes are infected with human herpesvirus (HHV), specifically herpes simplex virus-2 (HSV-2).
More similar words: simplesimpletonpessimistpessimismpessimisticpure and simplesimple machinesimple interestherpesgenital herpesperplexcomplexperplexedsimplyperplexityperplexingperplexedlycomplexioncomplexitysimplifysimplisticsimplicitypimpledimplewimpleoedipus complexdimpledcrimplecomplex sentencesuperiority complex
Total 57, 30 Per page  2/2  «first  pre  last»  goto
Leave a comment
Welcome to leave a comment about this page!
Your name:
Latest commentsInto the comment page>>
More words